Description
LL-37 – Antimicrobial & Immunomodulatory Research Peptide
LL-37 5 mg is the human cathelicidin host-defense peptide (37 amino acids) known for broad-spectrum antimicrobial, anti-biofilm, and immunomodulatory activity. As an amphipathic α-helical peptide, LL-37 disrupts microbial membranes and modulates innate immune responses, supporting research in infection control, wound healing, mucosal defense, and inflammation.
Key Features & Research Applications
🦠 Broad Antimicrobial Spectrum
Active against Gram-positive/Gram-negative bacteria, select fungi, and some enveloped viruses via membrane disruption and LPS/LTA neutralization.
🧫 Anti-Biofilm Activity
Interferes with biofilm formation and helps disperse established biofilms—useful in chronic infection models.
🛡️ Immunomodulation
Modulates cytokine profiles; chemotactic effects (e.g., via FPR2) support studies of innate/adaptive immune crosstalk.
🩹 Wound & Epithelial Repair
Promotes re-epithelialization, angiogenesis, and barrier integrity in skin and mucosal models.
🌬️ Mucosal Defense Research
Evaluated in respiratory, oral, GI, and urogenital systems for host-pathogen interactions and barrier protection.
Product Details
-
Name: LL-37 (Human Cathelicidin)
-
Form: Lyophilized powder
-
Sequence (37 aa): [LL-37, 37 aa]
-
Molecular Weight: ~4,493 Da
-
Purity: ≥ 98% (HPLC verified)
-
Dosage Strength: 5 mg per vial
-
Appearance: White to off-white lyophilized powder
-
Storage: Store dry at 35.6–46.4°F; after reconstitution, aliquot and freeze (−4°F) to avoid repeat freeze–thaw; protect from light and moisture
-
Solubility: Sterile water or mild aqueous buffers; gentle agitation recommended
-
Packaging: Sterile, sealed research-grade vial
-
Verification: Third-party tested for identity and purity
